{"product_id":"proteintech-17017-1-ap","title":"Proteintech, 17017-1-AP, ADPRM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADPRM (17017-1-AP) by Proteintech is a Polyclonal antibody targeting ADPRM in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n17017-1-AP targets ADPRM in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  pig brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADPRM (ADP-ribose\/CDP-alcohol diphosphatase, manganese dependent) is a manganese-dependent glycophosphatase primarily responsible for the breakdown of molecules such as ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine in the cell. The protein is predicted to be located in the cytoplasm and possesses 2',3'-cyclic nucleotide 2'-phosphodiesterase activity, manganese ion-binding activity, and pyrophosphatase activity. ADPRM plays an important role in embryonic development, particularly in the formation of the heart and lungs. In addition, ADPRM may be involved in immune cell signaling, acting as a second messenger for ADP-ribose to activate TRPM2, which in turn regulates oxidative\/nitrosative stress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9997 Product name: Recombinant human C17orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC001294 Sequence: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGELFL Predict reactive species\nFull Name: chromosome 17 open reading frame 48\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC001294\nGene Symbol: C17orf48\nGene ID (NCBI): 56985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3LIE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869804089513,"sku":"17017-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17017-1-ap","provider":"Iright","version":"1.0","type":"link"}