{"product_id":"proteintech-17026-1-ap","title":"Proteintech, 17026-1-AP, GPR132 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR132 (17026-1-AP) by Proteintech is a Polyclonal antibody targeting GPR132 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n17026-1-AP targets GPR132 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR132, also known as G2A (G2 accumulation protein), belongs to the G-protein coupled receptor (GPCR) 1 family. GPR132 is a DNA damage and stress inducible GPCR that blocks cells in G2\/M. It functions at the G2\/M checkpoint to delay mitosis and may serve as a mechanism for T and B cells and other cell types to slow their proliferation and repair damaged DNA to ensure proper replication (PMID: 9770487). Lysophosphatidylcholine (LPC) is a high affinity ligand for GPR132 (PMID: 15653487).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10325 Product name: Recombinant human GPR132 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 214-380 aa of BC084546 Sequence: IIAFTNHRIFRSIKQSMGLSAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC Predict reactive species\nFull Name: G protein-coupled receptor 132\nCalculated Molecular Weight: 380 aa, 43 kDa\nGenBank Accession Number: BC084546\nGene Symbol: GPR132\nGene ID (NCBI): 29933\nRRID: AB_2113375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998717609,"sku":"17026-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17026-1-ap","provider":"Iright","version":"1.0","type":"link"}