{"product_id":"proteintech-17047-1-ap","title":"Proteintech, 17047-1-AP, ROGDI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ROGDI (17047-1-AP) by Proteintech is a Polyclonal antibody targeting ROGDI in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n17047-1-AP targets ROGDI in WB, IHC, IF, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  human kidney tissue,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissue,  human placenta tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nROGDI encoded by the ROGDI gene, which encodes a leucine-zipper protein with high expression in the human spinal cord and brain, acts as a positive regulator of cell proliferation. Defections of ROGDI are the cause of Kohlschuetter-Toenz syndrome (KTZS)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, drosophila\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10688 Product name: Recombinant human ROGDI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC012901 Sequence: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPF Predict reactive species\nFull Name: rogdi homolog (Drosophila)\nCalculated Molecular Weight: 287 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC012901\nGene Symbol: ROGDI\nGene ID (NCBI): 79641\nRRID: AB_2182328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZN7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988068009,"sku":"17047-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17047-1-ap","provider":"Iright","version":"1.0","type":"link"}