{"product_id":"proteintech-17063-1-ap","title":"Proteintech, 17063-1-AP, ZNF22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF22 (17063-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF22 in WB, ELISA applications with reactivity to human, mouse, rat samples\n17063-1-AP targets ZNF22 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF22, also named as Zinc finger protein 22, is a 224 amino acid protein, which contains 5 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. In the embryo, ZNF22 is expressed in developing craniofacial structures including dental epithelium of maxillary molar tooth organs, tongue epithelium and muscle, and craniofacial bone osteoblasts. In the adult, ZNF22 is expressed in mesoderm-derived tissues such as skeletal muscle, heart, kidney and liver. Intermediate expression in spleen, thymus and brain. ZNF22 binds DNA through the consensus sequence 5'-CAATG-3' and may be involved in transcriptional regulation and may play a role in tooth formation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10833 Product name: Recombinant human ZNF22 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-224 aa of BC010642 Sequence: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR Predict reactive species\nFull Name: zinc finger protein 22 (KOX 15)\nCalculated Molecular Weight: 224 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC010642\nGene Symbol: ZNF22\nGene ID (NCBI): 7570\nRRID: AB_2878343\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17026\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869795733673,"sku":"17063-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17063-1-ap","provider":"Iright","version":"1.0","type":"link"}