{"product_id":"proteintech-17069-1-ap","title":"Proteintech, 17069-1-AP, EIF5A1\/EIF5A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF5A1\/EIF5A2 (17069-1-AP) by Proteintech is a Polyclonal antibody targeting EIF5A1\/EIF5A2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n17069-1-AP targets EIF5A1\/EIF5A2 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, A2780 cells,  mouse testis tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human prostate cancer tissue, human colon cancer tissue,  human stomach cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEukaryotic initiation factor 5A (EIF5A) plays an essential role in the viability of eukaryotic cells. EIF5A is known to act as a translation initiation factor specific for a small number of mRNAs, a cellular target of HIV-1 REV protein, and an exportin-4-dependent nuclear export cargo. It is also involved in mRNA turnover and the establishment of actin polarity. [PMID:16157662]. EIF5A2, one isoform of EIF5A, has a key at the level of mRNA turnoverby acting downstream of decapping. It also involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity [PMID:14622290]. EIF5A2 shares 84% identity of amino acid sequence with EIF5A1 isoform, so EIF5A2 poly-antibody could recognize both EIF5A2 and EIF5A1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10895 Product name: Recombinant human EIF5A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC036072 Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Predict reactive species\nFull Name: eukaryotic translation initiation factor 5A2\nCalculated Molecular Weight: 153 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC036072\nGene Symbol: EIF5A2\nGene ID (NCBI): 56648\nRRID: AB_2262009\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868896841897,"sku":"17069-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17069-1-ap","provider":"Iright","version":"1.0","type":"link"}