{"product_id":"proteintech-17076-1-ap","title":"Proteintech, 17076-1-AP, CST6 \/ Cystatin E\/M Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CST6 \/ Cystatin E\/M (17076-1-AP) by Proteintech is a Polyclonal antibody targeting CST6 \/ Cystatin E\/M in IHC, ELISA applications with reactivity to human, mouse samples\n17076-1-AP targets CST6 \/ Cystatin E\/M in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissue, mouse skin tissue,  mouse heart tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10965 Product name: Recombinant human CST6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-149 aa of BC031334 Sequence: ERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM Predict reactive species\nFull Name: cystatin E\/M\nCalculated Molecular Weight: 149 aa, 17 kDa\nGenBank Accession Number: BC031334\nGene Symbol: CST6\nGene ID (NCBI): 1474\nRRID: AB_2878345\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15828\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454684329,"sku":"17076-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17076-1-ap","provider":"Iright","version":"1.0","type":"link"}