{"product_id":"proteintech-17078-1-ap","title":"Proteintech, 17078-1-AP, TBC1D5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBC1D5 (17078-1-AP) by Proteintech is a Polyclonal antibody targeting TBC1D5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n17078-1-AP targets TBC1D5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293T cells,  Jurkat cells,  PC-3 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTBC1D5, a member of TBC (Tre2\/Bub2\/Cdc16)1 domain family, is a novel retromer-interacting protein. TBC1D5 is a Rab GTPase-activating proteins (GAPs) proteins that negatively regulates VPS35\/29\/26 recruitment and causes Rab7 to dissociate from the membrane. TBC1D5 could bridge the endosome and autophagosome via its C-terminal LIR motif, and Rab GAPs are implicated in the reprogramming of the endocytic trafficking events under starvation-induced autophagy. The TBC1D5 protein exists 89 kDa and 91 kDa isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10991 Product name: Recombinant human TBC1D5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 445-795 aa of BC013145 Sequence: TNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI Predict reactive species\nFull Name: TBC1 domain family, member 5\nCalculated Molecular Weight: 795 aa, 89 kDa\nObserved Molecular Weight: 89 kDa\nGenBank Accession Number: BC013145\nGene Symbol: TBC1D5\nGene ID (NCBI): 9779\nRRID: AB_2199389\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92609\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908834985,"sku":"17078-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17078-1-ap","provider":"Iright","version":"1.0","type":"link"}