{"product_id":"proteintech-17096-1-ap","title":"Proteintech, 17096-1-AP, SPHK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPHK2 (17096-1-AP) by Proteintech is a Polyclonal antibody targeting SPHK2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n17096-1-AP targets SPHK2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, mouse brain tissue,  human kidney tissue,  A549 cells,  mouse heart tissue,  rat brain tissue,  Raji cells,  HCT 116 cells,  mouse kidney tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human breast cancer tissue, human kidney tissue,  human liver tissue,  mouse kidney tissue,  rat kidney tissue,  rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPHK2(Sphingosine kinase 2) is also named as SK2, SPK2 and catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. SPHK2 associates with HDAC1 and HDAC2 in repressor complexes and is selectively enriched at the promoters of the genes encoding the cyclin-dependent kinase inhibitor p21 or the transcriptional regulator c-fos, where it enhanced local histone H3 acetylation and transcription.SphK2 is a ~66kDa protein that is most abundantly expressed in the liver and heart(PMID:19168577). SphK2 has two splice variants, which are the 68-kDa SphK2-S and the NH2-terminal extended 72-kDa SphK2-L (PMID:17974990).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10569 Product name: Recombinant human SPHK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 266-618 aa of BC010671 Sequence: LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP Predict reactive species\nFull Name: sphingosine kinase 2\nCalculated Molecular Weight: 618 aa, 65 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC010671\nGene Symbol: SPHK2\nGene ID (NCBI): 56848\nRRID: AB_10598479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRA0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842578089,"sku":"17096-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17096-1-ap","provider":"Iright","version":"1.0","type":"link"}