{"product_id":"proteintech-17155-1-ap","title":"Proteintech, 17155-1-AP, LRRC8A\/SWELL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRC8A\/SWELL1 (17155-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC8A\/SWELL1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17155-1-AP targets LRRC8A\/SWELL1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat lung tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLRRC8A, also named as SWELL1, KIAA1437, and LRRC8, belongs to the LRRC8 family. LRRC8A is the essential subunit of the volume-regulated anion channel (VRAC), a key regulator of cell volume homeostasis. It forms heteromeric channels with other LRRC8 family members (B-E) to transport chloride, organic osmolytes, and drugs. This channel is crucial for processes like regulatory volume decrease (RVD), cell proliferation, and migration. Dysfunction of LRRC8A-VRAC is implicated in cancer chemotherapy resistance, stroke, and immune disorders (PMID: 24790029, PMID: 39550567, PMID: 40642832). The molecular weight of LRRC8A is 94 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10062 Product name: Recombinant human LRRC8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 464-810 aa of BC051322 Sequence: SIAQLTGLKELWLYHTAAKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA Predict reactive species\nFull Name: leucine rich repeat containing 8 family, member A\nCalculated Molecular Weight: 810 aa, 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC051322\nGene Symbol: LRRC8A\nGene ID (NCBI): 56262\nRRID: AB_2918050\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869469921449,"sku":"17155-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17155-1-ap","provider":"Iright","version":"1.0","type":"link"}