{"product_id":"proteintech-17161-1-ap","title":"Proteintech, 17161-1-AP, ACAD10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACAD10 (17161-1-AP) by Proteintech is a Polyclonal antibody targeting ACAD10 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17161-1-AP targets ACAD10 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACAD10(Acyl-CoA dehydrogenase family member 10) belongs to the acyl-CoA dehydrogenase family. ACAD10 has significant activity towards the branched-chain substrates R and S, 2 methyl-C15-CoA and is highly expressed in fetal but not adult brain. This pattern of expression is similar to that of LCAD, another ACAD previously shown to be involved in long branched chain fatty acid metabolism(PMID:21237683). It has 4 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10510 Product name: Recombinant human ACAD10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-237 aa of BC015056 Sequence: MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL Predict reactive species\nFull Name: acyl-Coenzyme A dehydrogenase family, member 10\nCalculated Molecular Weight: 26 kDa, 119 kDa\nObserved Molecular Weight: 119 kDa\nGenBank Accession Number: BC015056\nGene Symbol: ACAD10\nGene ID (NCBI): 80724\nRRID: AB_2219552\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6JQN1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869630320809,"sku":"17161-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17161-1-ap","provider":"Iright","version":"1.0","type":"link"}