{"product_id":"proteintech-17167-1-ap","title":"Proteintech, 17167-1-AP, FANK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FANK1 (17167-1-AP) by Proteintech is a Polyclonal antibody targeting FANK1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n17167-1-AP targets FANK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFANK1 (Fibronectin type 3 and ankyrin repeat domains protein 1), also known as HSD13. It is expected to be located in the nucleus. And mostly restricted to testis (PMID: 17604233). Fibronectin type III and ankyrin repeat domains 1(Fank1) is a nuclear protein expressed during the transition from the meiotic phase to the haploid phase of spermatogenesis. While little is known about the function of Fank1 during spermatogenesis, gene ontology analysis suggests that it may be a transcription factor. H. Wang explored the role of Fank1 using the yeast two-hybrid system to screen for cellular proteins that may interact with Fank1. In this screen, they identified the Jun activation domain-binding protein 1 (Jab1) as a potential Fank1-interacting protein (PMID: 20978819).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10639 Product name: Recombinant human FANK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-345 aa of BC024189 Sequence: MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC Predict reactive species\nFull Name: fibronectin type III and ankyrin repeat domains 1\nCalculated Molecular Weight: 345 aa, 38 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC024189\nGene Symbol: FANK1\nGene ID (NCBI): 92565\nRRID: AB_3669264\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TC84\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887635124393,"sku":"17167-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17167-1-ap","provider":"Iright","version":"1.0","type":"link"}