{"product_id":"proteintech-17215-1-ap","title":"Proteintech, 17215-1-AP, NLRX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NLRX1 (17215-1-AP) by Proteintech is a Polyclonal antibody targeting NLRX1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n17215-1-AP targets NLRX1 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  mouse skeletal muscle tissue,  MCF-7 cells,  HeLa cells,  mouse colon tissue,  mouse heart tissue,  THP-1 cells,  rat colon tissue,  rat heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human heart tissue, human liver tissue,  mouse heart tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNLRX1 (Nucleotide-binding oligomerization domain, leucine-rich repeat containing X1) is a member of the NOD-like receptor (NLR) family and is unique among NLRs due to its localization to the mitochondrial matrix. NLRX1 is a negative regulator of innate immunity, particularly in viral infections. It interacts with the mitochondrial antiviral signaling protein (MAVS) to attenuate antiviral responses. NLRX1 has been implicated in various diseases, including multiple sclerosis, colorectal cancer, and ischemia-reperfusion injury. Its role in controlling inflammation and mitochondrial function makes it a potential therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11000 Product name: Recombinant human NLRX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-708 aa of BC013199 Sequence: EAVAQAMVLEMFREEDYYNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTEAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLQGVAIQMCWKLPLLPYAHLWTPRMPSHWCFLLILMPPLPQWYDGLVAPRGRCT Predict reactive species\nFull Name: NLR family member X1\nCalculated Molecular Weight: 975 aa, 108 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC013199\nGene Symbol: NLRX1\nGene ID (NCBI): 79671\nRRID: AB_2236031\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869709993,"sku":"17215-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17215-1-ap","provider":"Iright","version":"1.0","type":"link"}