{"product_id":"proteintech-17228-1-ap","title":"Proteintech, 17228-1-AP, Granzyme H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Granzyme H (17228-1-AP) by Proteintech is a Polyclonal antibody targeting Granzyme H in WB, ELISA applications with reactivity to human samples\n17228-1-AP targets Granzyme H in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NK-92 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGranzyme H (GzmH) belongs to a family of 5 human serine proteases that are expressed by cytotoxic immune effector cells. It's regarded as an orphan granzyme with unknown biologic functions in immune defense cells. It's reported that this serine protease is predominantly expressed at high levels in natural killer (NK) cells and has chymotrypsin-like (chymase) activity. The calculated molecular weight is 27 kDa, 17228-1-AP can detect a band around 30 kDa. (PMID: 17409270)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11069 Product name: Recombinant human GZMH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC027974 Sequence: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL Predict reactive species\nFull Name: granzyme H (cathepsin G-like 2, protein h-CCPX)\nCalculated Molecular Weight: 246 aa, 27 kDa\nObserved Molecular Weight: ~30 kDa\nGenBank Accession Number: BC027974\nGene Symbol: Granzyme H\nGene ID (NCBI): 2999\nRRID: AB_3085518\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20718\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887659208873,"sku":"17228-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17228-1-ap","provider":"Iright","version":"1.0","type":"link"}