{"product_id":"proteintech-17247-1-ap","title":"Proteintech, 17247-1-AP, ATPB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATPB (17247-1-AP) by Proteintech is a Polyclonal antibody targeting ATPB in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17247-1-AP targets ATPB in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HT-29 cells,  HepG2 cells,  mouse brain tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human  colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP5B, also named as ATPMB and ATPSB, belongs to the ATPase alpha\/beta chains family. It is a high affinity HDL receptor for apolipoprotein A1. ATP5B is a subunit of mitochondrial ATP synthase (F1F0 ATP synthase or Complex V ). ATP5B has a calculated molecular mass of 57 kDa and ~5 kDa transit peptide can be removed in the mature form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11177 Product name: Recombinant human ATPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-529 aa of BC016512 Sequence: EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide\nCalculated Molecular Weight: 529 aa, 57 kDa\nObserved Molecular Weight: 45-57 kDa\nGenBank Accession Number: BC016512\nGene Symbol: ATPB\nGene ID (NCBI): 506\nRRID: AB_2061878\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06576\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868834386089,"sku":"17247-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17247-1-ap","provider":"Iright","version":"1.0","type":"link"}