{"product_id":"proteintech-17257-1-ap","title":"Proteintech, 17257-1-AP, NDUFA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA3 (17257-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA3 in WB, IHC, ELISA applications with reactivity to human samples\n17257-1-AP targets NDUFA3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  HeLa cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10912 Product name: Recombinant human NDUFA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC011021 Sequence: MAARVGAFLKNAWDKEPVLVVSFVVGGLEQSHDTTPRMLHDDPTLKRAHSMTNPTAASSRPHVSL Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa\nCalculated Molecular Weight: 65aa,7 kDa; 84aa,9 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC011021\nGene Symbol: NDUFA3\nGene ID (NCBI): 4696\nRRID: AB_2150631\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95167\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005566121,"sku":"17257-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17257-1-ap","provider":"Iright","version":"1.0","type":"link"}