{"product_id":"proteintech-17264-1-ap","title":"Proteintech, 17264-1-AP, MITD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MITD1 (17264-1-AP) by Proteintech is a Polyclonal antibody targeting MITD1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17264-1-AP targets MITD1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  MOLT-4 cells,  mouse kidney tissue,  rat kidney tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10998 Product name: Recombinant human MITD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC018453 Sequence: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI Predict reactive species\nFull Name: MIT, microtubule interacting and transport, domain containing 1\nCalculated Molecular Weight: 249 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC018453\nGene Symbol: MITD1\nGene ID (NCBI): 129531\nRRID: AB_2297522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WV92\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869004157097,"sku":"17264-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17264-1-ap","provider":"Iright","version":"1.0","type":"link"}