{"product_id":"proteintech-17314-1-ap","title":"Proteintech, 17314-1-AP, CLYBL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLYBL (17314-1-AP) by Proteintech is a Polyclonal antibody targeting CLYBL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17314-1-AP targets CLYBL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human heart tissue,  Jurkat cells,  THP-1 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLYBL, also named as CLB, is a Mitochondrial citramalyl-CoA lyase indirectly involved in the vitamin B12 metabolism (PubMed:29056341). It is a human mitochondrial enzyme of unknown function that is found in multiple eukaryotic taxa and conserved to bacteria. It acts as a beta-methylmalate synthase in vitro, by mediating conversion of glyoxylate and propionyl-CoA to beta-methylmalate. There're two isoforms with MW 31-33 kDa and 35-37 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11283 Product name: Recombinant human CLYBL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC034360 Sequence: MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK Predict reactive species\nFull Name: citrate lyase beta like\nCalculated Molecular Weight: 340 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC034360\nGene Symbol: CLYBL\nGene ID (NCBI): 171425\nRRID: AB_2083483\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N0X4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869453439145,"sku":"17314-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17314-1-ap","provider":"Iright","version":"1.0","type":"link"}