{"product_id":"proteintech-17328-1-ap","title":"Proteintech, 17328-1-AP, GSG1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSG1L (17328-1-AP) by Proteintech is a Polyclonal antibody targeting GSG1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17328-1-AP targets GSG1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, U-251 cells,  SGC-7901 cells,  mouse brain tissue,  mouse liver tissue,  rat brain tissue,  rat liver tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSG1L is a component of the inner core of AMPAR complex. It modifies AMPA receptor (AMPAR) gating. GSG1L is mainly present on B lymphocytes. This antibody can recognize all the 4 isoforms of GSG1L. GSG1L was detected the isoform of 43 kDa in rat brain (PMID: 22813734).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11307 Product name: Recombinant human GSG1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC016460 Sequence: MCLELFHSSNVIDGLKLNAFAAVFTVLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSFCLAWGSFTCCMAASVTTLNSYTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV Predict reactive species\nFull Name: GSG1-like\nCalculated Molecular Weight: 176 aa, 21 kDa\nObserved Molecular Weight: 36-43 kDa\nGenBank Accession Number: BC016460\nGene Symbol: GSG1L\nGene ID (NCBI): 146395\nRRID: AB_2878384\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXU4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869690417321,"sku":"17328-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17328-1-ap","provider":"Iright","version":"1.0","type":"link"}