{"product_id":"proteintech-17336-1-ap","title":"Proteintech, 17336-1-AP, CD1d Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD1d (17336-1-AP) by Proteintech is a Polyclonal antibody targeting CD1d in WB, ELISA applications with reactivity to human, mouse samples\n17336-1-AP targets CD1d in WB, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD1d is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. CD1d is an antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on NKT cells. When activated, NKT cells rapidly produce Th1 and Th2 cytokines. The molecular weight of unglycosylated CD1d is 38 kDa, while glycosylated form of CD1d is 48-50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11371 Product name: Recombinant human CD1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-302 aa of BC027926 Sequence: SAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSM Predict reactive species\nFull Name: CD1d molecule\nCalculated Molecular Weight: 335 aa, 38 kDa\nObserved Molecular Weight: 38-40 kDa, 50-55 kDa\nGenBank Accession Number: BC027926\nGene Symbol: CD1d\nGene ID (NCBI): 912\nRRID: AB_2878387\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15813\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869652537513,"sku":"17336-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17336-1-ap","provider":"Iright","version":"1.0","type":"link"}