{"product_id":"proteintech-17346-1-ap","title":"Proteintech, 17346-1-AP, C1r Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1r (17346-1-AP) by Proteintech is a Polyclonal antibody targeting C1r in WB, IHC, ELISA applications with reactivity to human samples\n17346-1-AP targets C1r in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human blood\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe first component of complement is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. The serine protease subunits C1r and C1s form a Ca(2+)-dependent C1s-C1r-C1r-C1s tetramer. C1r acts by transforming the activation signal into an enzymic activity. C1r is a single-chain glycoprotein that can be cleaved into an A chain and a B chain upon activation. This antibody recognizes the full-length C1r chain and the cleaved B chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11390 Product name: Recombinant human C1R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-705 aa of BC035220 Sequence: AVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED Predict reactive species\nFull Name: complement component 1, r subcomponent\nCalculated Molecular Weight: 705 aa, 80 kDa\nObserved Molecular Weight: 85 kDa, 30 kDa\nGenBank Accession Number: BC035220\nGene Symbol: C1R\nGene ID (NCBI): 715\nRRID: AB_2878392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869519859881,"sku":"17346-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17346-1-ap","provider":"Iright","version":"1.0","type":"link"}