{"product_id":"proteintech-17365-1-ap","title":"Proteintech, 17365-1-AP, AP1S3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP1S3 (17365-1-AP) by Proteintech is a Polyclonal antibody targeting AP1S3 in IHC, ELISA applications with reactivity to human, mouse samples\n17365-1-AP targets AP1S3 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP1S3 is a subunit of the adaptor complex AP-1. It belongs to the adaptor complexes small subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10751 Product name: Recombinant human AP1S3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-104 aa of BC021898 Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA Predict reactive species\nFull Name: adaptor-related protein complex 1, sigma 3 subunit\nCalculated Molecular Weight: 104aa,11 kDa; 154aa,18 kDa\nGenBank Accession Number: BC021898\nGene Symbol: AP1S3\nGene ID (NCBI): 130340\nRRID: AB_3085522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971184297,"sku":"17365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17365-1-ap","provider":"Iright","version":"1.0","type":"link"}