{"product_id":"proteintech-17390-1-ap","title":"Proteintech, 17390-1-AP, ALDH1L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH1L1 (17390-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1L1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples\n17390-1-AP targets ALDH1L1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse liver,  rat liver\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAldehyde dehydrogenase 1 family member L1 (ALDH1L1), belongs to the aldehyde dehydrogenase family of proteins and is responsible for formate oxidation in vivo. Loss of ALDH1L1 is associated with decreased apoptosis, increased cell motility, and cancer progression. ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 has some isoforms with MW of 99, 88 and 55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11285 Product name: Recombinant human ALDH1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-505 aa of BC027241 Sequence: DDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMYRAPPSPSTRPDPTAT Predict reactive species\nFull Name: aldehyde dehydrogenase 1 family, member L1\nCalculated Molecular Weight: 99 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC027241\nGene Symbol: ALDH1L1\nGene ID (NCBI): 10840\nRRID: AB_2878401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75891\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895891625,"sku":"17390-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17390-1-ap","provider":"Iright","version":"1.0","type":"link"}