{"product_id":"proteintech-17402-1-ap","title":"Proteintech, 17402-1-AP, CXCL12\/SDF-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL12\/SDF-1 (17402-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL12\/SDF-1 in IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n17402-1-AP targets CXCL12\/SDF-1 in IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ). This antibody can detect all the isoforms of CXCL12\/SDF1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11379 Product name: Recombinant human CXCL12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-89 aa of BC039893 Sequence: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)\nCalculated Molecular Weight: 89 aa, 10 kDa\nGenBank Accession Number: BC039893\nGene Symbol: CXCL12\/SDF-1\nGene ID (NCBI): 6387\nRRID: AB_2878404\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48061\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868834943145,"sku":"17402-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17402-1-ap","provider":"Iright","version":"1.0","type":"link"}