{"product_id":"proteintech-17467-1-ap","title":"Proteintech, 17467-1-AP, FKBP11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FKBP11 (17467-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP11 in WB, ELISA applications with reactivity to human samples\n17467-1-AP targets FKBP11 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFKBP11 (FK506 binding protein 11, also named FKBP19) was first described as predominantly expressed in secretory tissues including the pancreas and recent studies have suggested a role in beta cell survival under conditions of ER stress (PMID: 35456020). In addition, FKBP11 appears to play a role in osteoblasts and bone formation where it has been observed to associate with interferon-inducible transmembrane protein 5 (IFITM5) (PMID: 24058703).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11368 Product name: Recombinant human FKBP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-201 aa of BC027973 Sequence: AEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK Predict reactive species\nFull Name: FK506 binding protein 11, 19 kDa\nCalculated Molecular Weight: 201 aa, 22 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC027973\nGene Symbol: FKBP11\nGene ID (NCBI): 51303\nRRID: AB_3669276\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYL4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887640989865,"sku":"17467-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17467-1-ap","provider":"Iright","version":"1.0","type":"link"}