{"product_id":"proteintech-17491-1-ap","title":"Proteintech, 17491-1-AP, USP20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP20 (17491-1-AP) by Proteintech is a Polyclonal antibody targeting USP20 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17491-1-AP targets USP20 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissue, human testis tissue,  human brain tissue,  human spleen tissue,  human lung tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP20(ubiquitin carboxyl-terminal hydrolase 20) is also named as KIAA1003, LSFR3A, VDU2 and belongs to the peptidase C19 family and the USP20\/USP33 subfamily. It can specifically deubiquitinate and stabilize HIF1A and, therefore, increase expression of HIF-1alpha targeted genes, such as vascular endothelial growth factor (VEGF). It also plays a central role in ADRB2 recycling and resensitization after prolonged agonist stimulation by constitutively binding ADRB2, mediating deubiquitination of ADRB2 and inhibiting lysosomal trafficking of ADRB2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11590 Product name: Recombinant human USP20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC039593 Sequence: MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVD Predict reactive species\nFull Name: ubiquitin specific peptidase 20\nCalculated Molecular Weight: 914 aa, 102 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC039593\nGene Symbol: USP20\nGene ID (NCBI): 10868\nRRID: AB_2212570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2K6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895695017,"sku":"17491-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17491-1-ap","provider":"Iright","version":"1.0","type":"link"}