{"product_id":"proteintech-17503-1-ap","title":"Proteintech, 17503-1-AP, GNG11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNG11 (17503-1-AP) by Proteintech is a Polyclonal antibody targeting GNG11 in WB, ELISA applications with reactivity to human, mouse, rat samples\n17503-1-AP targets GNG11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, mouse retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanine nucleotide-binding protein G(I)\/G(S)\/G(O) subunit gamma-11 (GBG11) is a subunit of Guanine nucleotide-binding proteins (G proteins). G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11698 Product name: Recombinant human GNG11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC009709 Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma 11\nCalculated Molecular Weight: 73 aa, 9 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC009709\nGene Symbol: GNG11\nGene ID (NCBI): 2791\nRRID: AB_2109758\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61952\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653802153,"sku":"17503-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17503-1-ap","provider":"Iright","version":"1.0","type":"link"}