{"product_id":"proteintech-17554-1-ap","title":"Proteintech, 17554-1-AP, MTA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTA2 (17554-1-AP) by Proteintech is a Polyclonal antibody targeting MTA2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17554-1-AP targets MTA2 in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  mouse thymus tissue,  HEK-293 cells\nPositive IP detected in: mouse thymus tissue\nPositive IHC detected in: rat lung tissue, human heart tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMetastasis-associated protein MTA2, also named as MTA1L1 or PID, is a 668 amino acid protein, which contains one BAH domain, one ELM2 domain, one GATA-type zinc finger and one SANT domain. MTA2 localizes in the nucleus and is widely expressed in many tissues. MTA2 may be involved in the regulation of gene expression as repressor and activator.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11713 Product name: Recombinant human MTA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC053650 Sequence: MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV Predict reactive species\nFull Name: metastasis associated 1 family, member 2\nCalculated Molecular Weight: 668 aa, 75 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC053650\nGene Symbol: MTA2\nGene ID (NCBI): 9219\nRRID: AB_10638601\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94776\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868984692905,"sku":"17554-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17554-1-ap","provider":"Iright","version":"1.0","type":"link"}