{"product_id":"proteintech-17617-1-ap","title":"Proteintech, 17617-1-AP, CD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD3 (17617-1-AP) by Proteintech is a Polyclonal antibody targeting CD3 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n17617-1-AP targets CD3 in WB, IHC, IF-P, IF-Fro, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, pig spleen tissue,  MOLT-4 cells,  mouse thymus tissue,  rat thymus tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human tonsillitis tissue, mouse spleen tissue,  human lymphoma tissue,  human lung cancer tissue,  human breast cancer tissue,  mouse colon tissue,  human pancreas cancer tissue,  rat thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue, mouse spleen tissue\nPositive IF-Fro detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR\/CD3 complex of T-lymphocytes consists of either a TCR alpha\/beta or TCR gamma\/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a polyclonal antibody directed against the epsilon chain of human CD3 molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11797 Product name: Recombinant human CD3E protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-207 aa of BC049847 Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Predict reactive species\nFull Name: CD3e molecule, epsilon (CD3-TCR complex)\nCalculated Molecular Weight: 207 aa, 23 kDa\nObserved Molecular Weight: 23-25 kDa\nGenBank Accession Number: BC049847\nGene Symbol: CD3\nGene ID (NCBI): 916\nENSEMBL Gene ID: ENSG00000198851\nRRID: AB_1939430\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07766\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868824260777,"sku":"17617-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17617-1-ap","provider":"Iright","version":"1.0","type":"link"}