{"product_id":"proteintech-17649-1-ap","title":"Proteintech, 17649-1-AP, TIAR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIAR (17649-1-AP) by Proteintech is a Polyclonal antibody targeting TIAR in WB, IHC, ELISA applications with reactivity to human samples\n17649-1-AP targets TIAR in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIAR, also named as TIA 1 related protein, is an RNA-binding protein which is associated with apoptosis. It has been shown that mouse with disrupted TIAR gene show high levels of embryonic lethality. TIAR plays an important role in cytoplasm and nucleus where it can control translation of some specific mRNAs and activate splicing of exons with weak 5-splice sites.. Besides, TIAR also has the 28 kDa and 50 kDa proteins for TIAR exists in multiple alternative splicing forms.(PMID: 12533540, 7533298, 22851315, 8176212)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11884 Product name: Recombinant human TIAR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-252 aa of BC030025 Sequence: MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ Predict reactive species\nFull Name: TIA1 cytotoxic granule-associated RNA binding protein-like 1\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 38-43 kDa\nGenBank Accession Number: BC030025\nGene Symbol: TIAR\nGene ID (NCBI): 7073\nRRID: AB_3669280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01085\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869777449129,"sku":"17649-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17649-1-ap","provider":"Iright","version":"1.0","type":"link"}