{"product_id":"proteintech-17659-1-ap","title":"Proteintech, 17659-1-AP, SENP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SENP3 (17659-1-AP) by Proteintech is a Polyclonal antibody targeting SENP3 in WB, IHC, IP, ELISA applications with reactivity to human, rat samples\n17659-1-AP targets SENP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Y79 cells,  rat embryo tissue\nPositive IP detected in: Y79 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSENP3(Sentrin-specific protease 3) is also named as SSP3, SUSP3 and belongs to the peptidase C48 family. It acts as an essential factor for ribosome biogenesis. SENP3 might regulate the sumoylation of other substrates through directly binding or mediating association with NPM1 at the nucleolus and other subcellular compartments.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11911 Product name: Recombinant human SENP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-574 aa of BC080658 Sequence: GLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV Predict reactive species\nFull Name: SUMO1\/sentrin\/SMT3 specific peptidase 3\nCalculated Molecular Weight: 574 aa, 65 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC080658\nGene Symbol: SENP3\nGene ID (NCBI): 26168\nRRID: AB_2301618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H4L4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868945076393,"sku":"17659-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17659-1-ap","provider":"Iright","version":"1.0","type":"link"}