{"product_id":"proteintech-17676-1-ap","title":"Proteintech, 17676-1-AP, OLAH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OLAH (17676-1-AP) by Proteintech is a Polyclonal antibody targeting OLAH in WB, ELISA applications with reactivity to human samples\n17676-1-AP targets OLAH in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, MCF-10A cells,  LNCap cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOLAH protein, also known as oleoyl-ACP hydrolase, is an enzyme involved in fatty acid production. It has been found to play a role in various biological processes and diseases. For instance, placental OLAH levels are altered in fetal growth restriction and preeclampsia, suggesting its potential involvement in placental dysfunction. Additionally, OLAH has been linked to severe respiratory diseases, where it mediates life-threatening inflammation associated with viral infections. Its expression is also associated with fatal outcomes in certain viral infections. These findings highlight the importance of OLAH in both reproductive health and infectious diseases (PMID: 36139751, PMID: 39137778, PMID: 39178832). OLAH has two isoforms with molecular masses of 30 kDa and 36 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11694 Product name: Recombinant human OLAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC050372 Sequence: MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISN Predict reactive species\nFull Name: oleoyl-ACP hydrolase\nCalculated Molecular Weight: 265 aa, 30 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC050372\nGene Symbol: OLAH\nGene ID (NCBI): 55301\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NV23\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887745552553,"sku":"17676-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17676-1-ap","provider":"Iright","version":"1.0","type":"link"}