{"product_id":"proteintech-17679-1-ap","title":"Proteintech, 17679-1-AP, MRPL55 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPL55 (17679-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL55 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17679-1-AP targets MRPL55 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRPL55, also named as L55mt and MRP-L55, is a component of the mitochondrial ribosome large subunit (39S). It acts dynamically in the cell during development. The MW of MRPL55 is about 13 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11716 Product name: Recombinant human MRPL55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC052806 Sequence: MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK Predict reactive species\nFull Name: mitochondrial ribosomal protein L55\nCalculated Molecular Weight: 128 aa, 15 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC052806\nGene Symbol: MRPL55\nGene ID (NCBI): 128308\nRRID: AB_2878427\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z7F7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869416476841,"sku":"17679-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17679-1-ap","provider":"Iright","version":"1.0","type":"link"}