{"product_id":"proteintech-17684-1-ap","title":"Proteintech, 17684-1-AP, VEZT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VEZT (17684-1-AP) by Proteintech is a Polyclonal antibody targeting VEZT in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17684-1-AP targets VEZT in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, human brain tissue,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVezatin (VEZT) is an adherens junctions transmembrane protein which identified as a putative tumor suppressor. In case of Listeria infection, it promotes bacterial internalization by participating in myosin VIIa recruitment to the entry site. There're two isoforms with calculated MW 89 kDa and 65 kDa. With modification or glycosylation, the MW in Western blot detection will be presented as ~125 kDa and ~89 kDa (PMID: 11080149) or 65-71 kDa and 88-100 kDa (PMID: 20049712). There're some isoforms with MW less than 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11786 Product name: Recombinant human VEZT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 382-731 aa of BC064939 Sequence: VRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENALEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQIIEENKNEIEEK Predict reactive species\nFull Name: vezatin, adherens junctions transmembrane protein\nCalculated Molecular Weight: 731 aa, 83 kDa\nObserved Molecular Weight: 89 kDa, 125 kDa\nGenBank Accession Number: BC064939\nGene Symbol: VEZT\nGene ID (NCBI): 55591\nRRID: AB_2213139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HBM0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887919845545,"sku":"17684-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17684-1-ap","provider":"Iright","version":"1.0","type":"link"}