{"product_id":"proteintech-17695-1-ap","title":"Proteintech, 17695-1-AP, OCRL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OCRL (17695-1-AP) by Proteintech is a Polyclonal antibody targeting OCRL in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17695-1-AP targets OCRL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  mouse brain tissue,  rat brain tissue,  SH-SY5Y cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOCRL is also named as INPP5F, OCRL1 and belongs to the 5-phosphatase gene family and that Lowe syndrome represents an inborn error of inositol phosphate metabolism(PMID: 9430698).The protein product of the gene that when mutated is responsible for Lowe syndrome, or oculocerebrorenal syndrome (OCRL), is an inositol polyphosphate 5-phosphatase.It may function in lysosomal membrane trafficking by regulating the specific pool of phosphatidylinositol 4,5-bisphosphate that is associated with lysosomes.It has 2 isoforms produced by alternative splicing.Defects in OCRL are the cause of Lowe oculocerebrorenal syndrome (OCRL) and Dent disease type 2 (DD2).This antibody is specific to OCRL.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11900 Product name: Recombinant human OCRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 538-893 aa of BC094726 Sequence: VDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED Predict reactive species\nFull Name: oculocerebrorenal syndrome of Lowe\nCalculated Molecular Weight: 893 aa, 103 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC094726\nGene Symbol: OCRL\nGene ID (NCBI): 4952\nRRID: AB_2298946\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01968\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971159721,"sku":"17695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17695-1-ap","provider":"Iright","version":"1.0","type":"link"}