{"product_id":"proteintech-17716-1-ap","title":"Proteintech, 17716-1-AP, USMG5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USMG5 (17716-1-AP) by Proteintech is a Polyclonal antibody targeting USMG5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17716-1-AP targets USMG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human liver tissue,  human brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12086 Product name: Recombinant human USMG5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-58 aa of BC072683 Sequence: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT Predict reactive species\nFull Name: up-regulated during skeletal muscle growth 5 homolog (mouse)\nCalculated Molecular Weight: 58 aa, 7 kDa\nObserved Molecular Weight: 6 kDa\nGenBank Accession Number: BC072683\nGene Symbol: USMG5\nGene ID (NCBI): 84833\nRRID: AB_2214288\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96IX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869389672617,"sku":"17716-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17716-1-ap","provider":"Iright","version":"1.0","type":"link"}