{"product_id":"proteintech-17724-1-ap","title":"Proteintech, 17724-1-AP, PRX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRX5 (17724-1-AP) by Proteintech is a Polyclonal antibody targeting PRX5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17724-1-AP targets PRX5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, HepG2 cells,  U-937 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxiredoxin 5 (Prx5) is a member of a family consisting of six antioxidant enzymes. Prx5 is ubiquitously expressed in various tissues including mitochondria and peroxisomes, implying that Prx5 functions as a regulator of the cellular oxidation state. Prx5 plays a critical role in protecting cells from oxidative stress by inhibiting the accumulation of reactive oxygen species and cell death. Prx5 has an intensive ROS scavenging activity because it is located in the cytosol and mitochondria. Prx5 expression was upregulated during adipogenesis and Prx5 overexpression suppressed adipogenesis by regulating cytosolic and mitochondrial ROS generation. (PMID: 29777756, PMID: 31505325, PMID: 22020876)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12118 Product name: Recombinant human Prx5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC110983 Sequence: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL Predict reactive species\nFull Name: peroxiredoxin 5\nCalculated Molecular Weight: 214 aa, 22 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC110983\nGene Symbol: PRX5\nGene ID (NCBI): 25824\nRRID: AB_2168628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30044\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872134825,"sku":"17724-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17724-1-ap","provider":"Iright","version":"1.0","type":"link"}