{"product_id":"proteintech-17747-1-ap","title":"Proteintech, 17747-1-AP, GRAF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRAF (17747-1-AP) by Proteintech is a Polyclonal antibody targeting GRAF in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17747-1-AP targets GRAF in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells,  human brain tissue,  mouse thymus tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: mouse brain tissue, human heart tissue,  human liver tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGTPase Regulator Associated with Focal Adhesion Kinase (GRAF), also known as Rho GTPase activating protein 26 (ARHGAP26) , is a GTPase-activating protein and inhibits the activity of Rho GTPases by promoting the hydrolytic ability of Rho GTPases. GRAF enhances the hydrolysis of GTPases and converts GTPases from an active form to an inactive form, thereby inhibiting signaling transduction. Deletion and mutation of GRAF can lead to promyelocytic leukemia, suggesting tumor suppressive activity of GRAF. GRAF was downregulated in glioblastoma and associated with cell proliferation and migration (PMID: 10908648, PMID: 17611651, PMID: 31004081). It has been reported that there are three splicing mutants of GRAF, namely GRAF1a (92 kDa),GRAF1b (86 kDa) and GRAF1c (75-82 kDa), and GRAF1b and GRAF1c are the major GRAF1 isoforms in adult brain, whereas GRAF1a is abundant in neonates(PMID: 35624318, PMID: 30626696).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12008 Product name: Recombinant human ARHGAP26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-759 aa of BC068555 Sequence: RGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL Predict reactive species\nFull Name: Rho GTPase activating protein 26\nCalculated Molecular Weight: 759 aa, 86 kDa\nObserved Molecular Weight: 92 kDa\nGenBank Accession Number: BC068555\nGene Symbol: ARHGAP26\nGene ID (NCBI): 23092\nRRID: AB_2059284\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNA1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869409431721,"sku":"17747-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17747-1-ap","provider":"Iright","version":"1.0","type":"link"}