{"product_id":"proteintech-17814-1-ap","title":"Proteintech, 17814-1-AP, PRPSAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRPSAP2 (17814-1-AP) by Proteintech is a Polyclonal antibody targeting PRPSAP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17814-1-AP targets PRPSAP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, mouse brain tissue,  HeLa cells,  rat brain tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRPSAP2, also named as PAP41, is 369 amino acid protein, which Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis. PRPSAP2 is another protein involved in nucleic acid metabolism. The PRPSAP2 gene encodes part of the enzyme PRPP synthetase, which catalyzes the formation of phosphoribosylpyrophosphate, being a primary substrate for newly formed purine and pyrimidine nucleotides. Depletion of the PRPP synthetase causes growth arrest], the reverse has not been shown. Overexpression of SHMT1 and PRPSAP2 (and also COPS3) has been reported to occur in multiple myelomas . PRPSAP2 exists several isoforms with the range of molecular weight about 35-43 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12132 Product name: Recombinant human PRPSAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-369 aa of BC106050 Sequence: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD Predict reactive species\nFull Name: phosphoribosyl pyrophosphate synthetase-associated protein 2\nCalculated Molecular Weight: 369 aa, 41 kDa\nObserved Molecular Weight: 37-41 kDa\nGenBank Accession Number: BC106050\nGene Symbol: PRPSAP2\nGene ID (NCBI): 5636\nRRID: AB_10598314\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60256\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869490958505,"sku":"17814-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17814-1-ap","provider":"Iright","version":"1.0","type":"link"}