{"product_id":"proteintech-17822-1-ap","title":"Proteintech, 17822-1-AP, DOK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOK1 (17822-1-AP) by Proteintech is a Polyclonal antibody targeting DOK1 in WB, IHC, ELISA applications with reactivity to human samples\n17822-1-AP targets DOK1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe downstream of tyrosine kinase 1gene (DOK1) has emerged as a newly identified tumor suppressor gene that encodes a multi-domain adapter protein and acts as a negative regulator of signaling pathways involved in several cellular functions. DOK1 inhibits cell proliferation, down regulates MAP kinase activity, and has an opposing role in leukemogenesis and promotes cell spreading, motility, and apoptosis. (PMID: 24809689)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12189 Product name: Recombinant human DOK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-267 aa of BC111055 Sequence: MFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Predict reactive species\nFull Name: docking protein 1, 62kDa (downstream of tyrosine kinase 1)\nCalculated Molecular Weight: 48 aa, 52 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC111055\nGene Symbol: DOK1\nGene ID (NCBI): 1796\nRRID: AB_2274420\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99704\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869675737257,"sku":"17822-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17822-1-ap","provider":"Iright","version":"1.0","type":"link"}