{"product_id":"proteintech-17881-1-ap","title":"Proteintech, 17881-1-AP, THOC7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe THOC7 (17881-1-AP) by Proteintech is a Polyclonal antibody targeting THOC7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17881-1-AP targets THOC7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human liver tissue,  HEK-293 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human kidney tissue, human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHOC7 is a member of the THO complex that associate with the mRNA export apparatus. It is required for efficient export of polyadenylated RNA. It acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP\/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11795 Product name: Recombinant human THOC7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC065012 Sequence: MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP Predict reactive species\nFull Name: THO complex 7 homolog (Drosophila)\nCalculated Molecular Weight: 204 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC065012\nGene Symbol: THOC7\nGene ID (NCBI): 80145\nRRID: AB_10548743\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6I9Y2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869777186985,"sku":"17881-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17881-1-ap","provider":"Iright","version":"1.0","type":"link"}