{"product_id":"proteintech-17918-1-ap","title":"Proteintech, 17918-1-AP, SNX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX5 (17918-1-AP) by Proteintech is a Polyclonal antibody targeting SNX5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17918-1-AP targets SNX5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse kidney tissue,  human kidney tissue,  Neuro-2a cells,  K-562 cells,  Jurkat cells,  U2OS cells\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX5 (Sorting nexin-5) was originally identified as a putative FANCA-binding protein (PMID: 10600472). SNX5 has a phox homology (PX) domain in the N-terminus. It is involved in several stages of intracellular trafficking. SNX5 is a component of the mammalian retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network or plasma membrane (PMID: 17148574; 26199408).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12330 Product name: Recombinant human SNX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC093623 Sequence: MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN Predict reactive species\nFull Name: sorting nexin 5\nCalculated Molecular Weight: 404 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC093623\nGene Symbol: SNX5\nGene ID (NCBI): 27131\nRRID: AB_2192708\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5X3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899397801,"sku":"17918-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17918-1-ap","provider":"Iright","version":"1.0","type":"link"}