{"product_id":"proteintech-17924-1-ap","title":"Proteintech, 17924-1-AP, S100A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A5 (17924-1-AP) by Proteintech is a Polyclonal antibody targeting S100A5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17924-1-AP targets S100A5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  human kidney tissue,  human liver tissue,  SH-SY5Y cells\nPositive IHC detected in: human meningioma tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12342 Product name: Recombinant human S100A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC093955 Sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK Predict reactive species\nFull Name: S100 calcium binding protein A5\nCalculated Molecular Weight: 110 aa, 13 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC093955\nGene Symbol: S100A5\nGene ID (NCBI): 6276\nRRID: AB_2183794\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P33763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869590835369,"sku":"17924-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17924-1-ap","provider":"Iright","version":"1.0","type":"link"}