{"product_id":"proteintech-17947-1-ap","title":"Proteintech, 17947-1-AP, RGN\/SMP30 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGN\/SMP30 (17947-1-AP) by Proteintech is a Polyclonal antibody targeting RGN\/SMP30 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17947-1-AP targets RGN\/SMP30 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse small intestine tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: rat kidney tissue, human liver tissue,  human kidney tissue,  human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRegucalcin (RGN), also known as SMP30, is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. SMP30 is preferentially localized in hepatocytes and renal proximal tubular epithelial cells. It is known to be related to aging, hepatocyte proliferation and tumorigenesis. It may be useful for HCC serologic screening, especially for the patients with AFP Negative. RGN encodes two isoforms: 33 kDa and 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12423 Product name: Recombinant human RGN,SMP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC073173 Sequence: MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG Predict reactive species\nFull Name: regucalcin (senescence marker protein-30)\nCalculated Molecular Weight: 299 aa, 33 kDa\nObserved Molecular Weight: 33 kDa, 25 kDa\nGenBank Accession Number: BC073173\nGene Symbol: RGN\/SMP30\nGene ID (NCBI): 9104\nRRID: AB_10644486\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15493\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914307241,"sku":"17947-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17947-1-ap","provider":"Iright","version":"1.0","type":"link"}