{"product_id":"proteintech-17982-1-ap","title":"Proteintech, 17982-1-AP, UGT8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGT8 (17982-1-AP) by Proteintech is a Polyclonal antibody targeting UGT8 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17982-1-AP targets UGT8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human brain tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUGT8, also known as galacotosylceramide synthase or CGT (ceramide galactosyltransferase), is a key enzyme for galacotosylceramide (GalCer) biosynthesis. It is an ER transmembrane protein and has limited tissue distribution, with predominance in Schwann cells, oligodendrocytes, kidneys, testes, and intestine. UGT8 is highly enriched in myelin in the central nervous system. Its expression levels are strongly associated with histological typing in human oligodendrogliomas and astrocytomas; can be used as molecular marker to distinguish these tumors. Higher UGT8 levels had also been linked to metastatic properties of cancer cells. This antibody specifically recognizes the endogenous UGT8.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12393 Product name: Recombinant human UGT8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-402 aa of BC075069 Sequence: FKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWK Predict reactive species\nFull Name: UDP glycosyltransferase 8\nCalculated Molecular Weight: 541 aa, 61 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC075069\nGene Symbol: UGT8\nGene ID (NCBI): 7368\nRRID: AB_2214254\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16880\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909588649,"sku":"17982-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17982-1-ap","provider":"Iright","version":"1.0","type":"link"}