{"product_id":"proteintech-17997-1-ap","title":"Proteintech, 17997-1-AP, INSL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INSL3 (17997-1-AP) by Proteintech is a Polyclonal antibody targeting INSL3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n17997-1-AP targets INSL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInsulin-like 3 (INSL3), a Leydig cell-specific hormone, is essential for testis descent during foetal life and bone metabolism in adults. Insl3-deficient mice exhibit bilateral undescended testes located high in the abdominal cavity. INSL3 is presumed also to conform to a heterodimeric A-B structure of approximately 6 kDa once released from the producing cells. It is possible that both the mature form of INSL3 (6.6 kDa) and the pro-form(s) of INSL3 (12-14 kDa) are secreted from mammalian Leydig cells (PMID: 19329805).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12455 Product name: Recombinant human INSL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 17-131 aa of BC071706 Sequence: LVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY Predict reactive species\nFull Name: insulin-like 3 (Leydig cell)\nCalculated Molecular Weight: 131 aa, 14 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC071706\nGene Symbol: INSL3\nGene ID (NCBI): 3640\nRRID: AB_2878479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51460\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869551841449,"sku":"17997-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17997-1-ap","provider":"Iright","version":"1.0","type":"link"}