{"product_id":"proteintech-18027-1-ap","title":"Proteintech, 18027-1-AP, TRPM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPM5 (18027-1-AP) by Proteintech is a Polyclonal antibody targeting TRPM5 in WB, IHC, IF, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n18027-1-AP targets TRPM5 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF detected in: mouse olfactory epithelium tissue\nPositive FC (Intra) detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF): IF : 1:50-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransient receptor potential (TRP) proteins are a diverse family of proteins with structural features typical of ion channels (PMID: 14634208). TRPM5 is a member of the TRPM (melastatin-like) subfamily which are Ca(2+)-permeable cation channels localized predominantly to the plasma membrane (PMID: 11864597). TRPM5 plays a central role in taste transduction (PMID: 17610722). TRPM5 is implicated in enhancing TRPA1 expression and may be involved in regulating insulin secretion (PMID: 21932052). Alternative splicing results in transcript variants encoding distinct isoforms with calculated molecular weights of 98 kDa or 131 kDa. It has been reported that TRPM5 is N-linked glycosylated at a unique site and TRPM5 glycosylation seems not to be involved in channel trafficking, but mainly in its functional regulation (PMID: 24605085).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12593 Product name: Recombinant human TRPM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC093787 Sequence: MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNLSHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWTKLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLD Predict reactive species\nFull Name: transient receptor potential cation channel, subfamily M, member 5\nCalculated Molecular Weight: 98 kDa, 131 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: BC093787\nGene Symbol: TRPM5\nGene ID (NCBI): 29850\nRRID: AB_2287825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937801897,"sku":"18027-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18027-1-ap","provider":"Iright","version":"1.0","type":"link"}