{"product_id":"proteintech-18042-1-ap","title":"Proteintech, 18042-1-AP, CCNY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCNY (18042-1-AP) by Proteintech is a Polyclonal antibody targeting CCNY in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18042-1-AP targets CCNY in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCNY, also named as C10orf9, CBCP1, CFP1, is a novel cyclin. CCNY acts as a cell-cycle regulator of Wnt signaling pathway during G2\/M phase by recruiting CDK14\/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12674 Product name: Recombinant human CCNY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC104773 Sequence: MEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS Predict reactive species\nFull Name: cyclin Y\nCalculated Molecular Weight: 33 kDa, 39 kDa\nObserved Molecular Weight: 33-39 kDa\nGenBank Accession Number: BC104773\nGene Symbol: CCNY\nGene ID (NCBI): 219771\nRRID: AB_2074004\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8ND76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868916273321,"sku":"18042-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18042-1-ap","provider":"Iright","version":"1.0","type":"link"}