{"product_id":"proteintech-18046-1-ap","title":"Proteintech, 18046-1-AP, PGLYRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGLYRP1 (18046-1-AP) by Proteintech is a Polyclonal antibody targeting PGLYRP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18046-1-AP targets PGLYRP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeptidoglycan recognition protein 1 (PGLYRP1, also known as PGRP-S) belongs to a family of evolutionary conserved innate immunity proteins, which in mammals also include PGLYRP2, PGLYRP3, and PGLYRP4 (PMID: 17275309; 20418257). PGLYRP1 is highly expressed in polymorphonuclear leukocytes and to a lower extent in many non-immune cells (PMID: 20418257). It recognizes bacterial peptidoglycan and functions in antibacterial immunity and inflammation (PMID: 20418257). PGLYRP1 has been identified as a ligand for TREM-1 (PMID: 25595774).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12690 Product name: Recombinant human PGLYRP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-196 aa of BC101845 Sequence: MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Predict reactive species\nFull Name: peptidoglycan recognition protein 1\nCalculated Molecular Weight: 196 aa, 22 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC101845\nGene Symbol: PGLYRP1\nGene ID (NCBI): 8993\nRRID: AB_3085550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75594\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887757906089,"sku":"18046-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18046-1-ap","provider":"Iright","version":"1.0","type":"link"}