{"product_id":"proteintech-18057-1-ap","title":"Proteintech, 18057-1-AP, DEFA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEFA1 (18057-1-AP) by Proteintech is a Polyclonal antibody targeting DEFA1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n18057-1-AP targets DEFA1 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human small intestine tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12592 Product name: Recombinant human DEFA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC093791 Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC Predict reactive species\nFull Name: defensin, alpha 1\nCalculated Molecular Weight: 94 aa, 10 kDa\nObserved Molecular Weight: 6 kDa\nGenBank Accession Number: BC093791\nGene Symbol: DEFA1\nGene ID (NCBI): 1667\nRRID: AB_2292842\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P59665\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869402878121,"sku":"18057-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18057-1-ap","provider":"Iright","version":"1.0","type":"link"}