{"product_id":"proteintech-18067-1-ap","title":"Proteintech, 18067-1-AP, KCNA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNA1 (18067-1-AP) by Proteintech is a Polyclonal antibody targeting KCNA1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n18067-1-AP targets KCNA1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPotassium voltage-gated channel subfamily A member 1 (KCNA1, also known as Kv1.1) is a voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney (PMID: 19903818; 8845167). KCNA1 expression was reduced in human cancers, and this decrease correlated with an increase in breast cancer aggressiveness (PMID: 23774215). Furthermore, Kv1.1 is expressed in the brain as a mature glycoprotein, which is reported to be 86 kDa (PMID: 16305740).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12699 Product name: Recombinant human KCNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC101733 Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESS Predict reactive species\nFull Name: potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)\nCalculated Molecular Weight: 495 aa, 56 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: BC101733\nGene Symbol: KCNA1\nGene ID (NCBI): 3736\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q09470\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887690731689,"sku":"18067-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18067-1-ap","provider":"Iright","version":"1.0","type":"link"}